PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G0703
Common NameMYBA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 249aa    MW: 29073.7 Da    PI: 6.9361
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G0703genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-181057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll+++++++G g W+ ++++ g++R++k+c++rw++yl
      Gh_A07G0703 10 KGAWTEEEDLLLKKCIEKYGEGKWHQVPARAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding45.61.7e-1463108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg + ++E +l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A07G0703  63 RGHFAADEVDLIIRLHNLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      6778899***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.367561IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-23759IPR009057Homeodomain-like
SuperFamilySSF466895.5E-297104IPR009057Homeodomain-like
SMARTSM007174.2E-16959IPR001005SANT/Myb domain
PfamPF002494.6E-171057IPR001005SANT/Myb domain
CDDcd001679.06E-121257No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2260111IPR009057Homeodomain-like
PROSITE profilePS5129417.61662112IPR017930Myb domain
SMARTSM007172.9E-1362110IPR001005SANT/Myb domain
PfamPF002492.8E-1363108IPR001005SANT/Myb domain
CDDcd001671.50E-968108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MEGSSLRVRK GAWTEEEDLL LKKCIEKYGE GKWHQVPARA GLNRCRKSCR LRWLNYLKPN  60
IKRGHFAADE VDLIIRLHNL LGNRWSLIAG RLPGRTANDV KNYWNTHLLK KNIDTSSKTS  120
NPKSHKLKPN TKVIKPRPQI LSKRSFLVNL DEYNNNNNNN NNDRVETSNN VVLADCSDNH  180
DGYCFLDHDE MMWWENMMMN EKEVDGHQLQ CSANDIDQSV LDQIMNEDNY GNTMDELFLD  240
EELWNVFNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-22101157110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.209450.0boll
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7494300.0KF749430.1 Gossypium hirsutum cultivar Xincaimian 6 myb-related transcription factor A1 (MYBA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471874.11e-165PREDICTED: transcription factor MYB113-like isoform X1
SwissprotQ9FNV95e-66MY113_ARATH; Transcription factor MYB113
TrEMBLW5RYW90.0W5RYW9_G
STRINGVIT_02s0033g00410.t012e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-64myb domain protein 113